PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G213600.1
Common NameB456_008G213600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 195aa    MW: 21902.8 Da    PI: 10.1576
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G213600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.7e-1496141247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++WT+eE+  ++++ ++lG+g+W+ I++   + Rt+ q+ s+ qky
  Gorai.008G213600.1  96 KPWTEEEHRMFLEGLRKLGKGDWRGISKNYVTSRTPVQVASHAQKY 141
                         58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.598724IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.7490146IPR017930Myb domain
TIGRFAMsTIGR015572.8E-1893144IPR006447Myb domain, plants
SuperFamilySSF466895.67E-1793146IPR009057Homeodomain-like
SMARTSM007172.2E-1194144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-1196140IPR009057Homeodomain-like
PfamPF002493.3E-1296141IPR001005SANT/Myb domain
CDDcd001673.77E-1197142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MAKGTGRKCS HCGHNGHNSR TCSNGKGGYV KLFGVNIAAM AQTQECLMQR SFSMGNLPFH  60
AENHNNGGGV DDGYFSEGHT HSENHNAAAH DIKRAKPWTE EEHRMFLEGL RKLGKGDWRG  120
ISKNYVTSRT PVQVASHAQK YFLRLQAAGN NRKKRRPSLF DMSFQESKSE SVLPLNPILT  180
TCLYVQFNLF MLMTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012435738.11e-126PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A0D2TA311e-147A0A0D2TA31_G
STRINGfgenesh2_kg.8__2146__AT5G61620.17e-55(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.14e-57MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]